PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN18311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 142aa    MW: 16600.9 Da    PI: 10.4625
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN18311.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.4e-143176147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teE ++l+++v+++ + +W++I+r++  gR+ k c +rw + 
       KHN18311.1 31 KGPWSTEEVQILIRLVERYDPQNWSLISRYIK-GRSNKLCLLRWCNQ 76
                     79*****************************9.***********985 PP

2Myb_DNA-binding42.81.2e-1385127347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +++++E + ++ a +++ ++ W+tIar ++ gRt + +k++w++ 
       KHN18311.1  85 PFSAQENDTIIVAYAKYDNR-WATIARLLP-GRTNNAIKNHWNSI 127
                      79******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.4312681IPR017930Myb domain
SuperFamilySSF466896.74E-2828124IPR009057Homeodomain-like
SMARTSM007178.0E-113079IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-193284IPR009057Homeodomain-like
CDDcd001671.41E-93375No hitNo description
PfamPF139211.1E-133491No hitNo description
SMARTSM007177.6E-1182130IPR001005SANT/Myb domain
PROSITE profilePS5129413.57383132IPR017930Myb domain
CDDcd001672.02E-785128No hitNo description
Gene3DG3DSA:1.10.10.608.9E-2085131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MEVTNKSSSF TFSSFDCCSS ESNPNKPSRI KGPWSTEEVQ ILIRLVERYD PQNWSLISRY  60
IKGRSNKLCL LRWCNQLSPP MEHRPFSAQE NDTIIVAYAK YDNRWATIAR LLPGRTNNAI  120
KNHWNSILKR RAKGIQRTDK WP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-342713254159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-342713254159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311921e-134KT031192.1 Glycine max clone HN_CCL_38 MYB/HD-like transcription factor (Glyma06g04010.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003535042.11e-102PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW15e-47MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0B2Q9Q41e-102A0A0B2Q9Q4_GLYSO; Transcription factor MYB44
TrEMBLK7LCR21e-102K7LCR2_SOYBN; Uncharacterized protein
STRINGGLYMA09G12164.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.14e-49myb domain protein 77
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]